SCOP 1.57: Domain d1b1zb1: 1b1z B:3-107

Lineage for d1b1zb1 (1b1z B:3-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (4 PDB entries)

8. Domain d1b1zb1: 1b1z B:3-107 [25217]
   Other proteins in same PDB: d1b1za2, d1b1zb2, d1b1zc2, d1b1zd2

Details for d1b1zb1

PDB Entry: 1b1z, 2.57 Å

PDB Description: streptococcal pyrogenic exotoxin a1

SCOP Domain Sequences for d1b1zb1:

Sequence; same for both SEQRES and ATOM records:

>d1b1zb1 b.40.2.2 (B:3-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

Timeline for d1b1zb1:

• d1b1zb1 first appeared (with stable ids) in SCOP 1.55
  
• d1b1zb1 appears in SCOP 1.59
  
• d1b1zb1 appears in the current release, SCOPe 2.08