Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (12 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [256267] (1 PDB entry) |
Domain d4gaaa2: 4gaa A:206-457 [252168] Other proteins in same PDB: d4gaaa1, d4gaaa3, d4gaab1, d4gaab3 automated match to d3funa2 complexed with bes, zn |
PDB Entry: 4gaa (more details), 2.26 Å
SCOPe Domain Sequences for d4gaaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gaaa2 d.92.1.0 (A:206-457) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} legrkvgprttiwtekellepsvyefaetekmlkyaedlagpyvwgqydllilppsfpyg gmenpcltfvtptvlagdrslasviaheishswtgnlvtnetwenfwlneghtvylerri dgrlygeefrqfkalggwkelqnsvntfgatnpltnlvpnlhevdvdaafssvpyekgfa llfyleqllggpeiflgflksyiqmfafksvtteewkkflysyfkdkvdildkvdwkgwm htpgmppvqpky
Timeline for d4gaaa2: