Class b: All beta proteins [48724] (176 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (4 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [256266] (1 PDB entry) |
Domain d4gaaa1: 4gaa A:2-205 [252167] Other proteins in same PDB: d4gaaa2, d4gaaa3, d4gaab2, d4gaab3 automated match to d2vj8a2 complexed with bes, zn |
PDB Entry: 4gaa (more details), 2.26 Å
SCOPe Domain Sequences for d4gaaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gaaa1 b.98.1.0 (A:2-205) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} adpssfaspekfnikhmhlklhvdftsraiaastsltvrslqdslaslildtkdltikkv avngkdatfalgtthsfkgtpleitlpfsltrgqeviveidsvtspkssalqwlnkeqta gkihpylfsqcqathcrsiipcqdtpsvkftyysqvsvpkelmalmsalrdgelseqsds nrkiyrfkqnvpipsylialvvga
Timeline for d4gaaa1: