Lineage for d4g7rb1 (4g7r B:3-36)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956780Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1956890Family f.17.2.0: automated matches [227239] (1 protein)
    not a true family
  6. 1956891Protein automated matches [226999] (2 species)
    not a true protein
  7. 1956895Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries)
  8. 1956899Domain d4g7rb1: 4g7r B:3-36 [252159]
    Other proteins in same PDB: d4g7ra_, d4g7rb2
    automated match to d2qpdb2
    complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g7rb1

PDB Entry: 4g7r (more details), 3.05 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236A from Thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4g7rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7rb1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dehkahkailayekgwlafslamlfvfialiayt

SCOPe Domain Coordinates for d4g7rb1:

Click to download the PDB-style file with coordinates for d4g7rb1.
(The format of our PDB-style files is described here.)

Timeline for d4g7rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g7rb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4g7ra_