Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.0: automated matches [227239] (1 protein) not a true family |
Protein automated matches [226999] (2 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries) |
Domain d4g7rb1: 4g7r B:3-36 [252159] Other proteins in same PDB: d4g7ra_, d4g7rb2 automated match to d2qpdb2 complexed with cu, cua, has, hem, olc, per; mutant |
PDB Entry: 4g7r (more details), 3.05 Å
SCOPe Domain Sequences for d4g7rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7rb1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dehkahkailayekgwlafslamlfvfialiayt
Timeline for d4g7rb1: