SCOPe 2.04: Domain d4g7rb1: 4g7r B:3-36

Lineage for d4g7rb1 (4g7r B:3-36)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.0: automated matches [227239] (1 protein)
   not a true family

6. Protein automated matches [226999] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries)

8. Domain d4g7rb1: 4g7r B:3-36 [252159]
   Other proteins in same PDB: d4g7ra_, d4g7rb2
   automated match to d2qpdb2
   complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g7rb1

PDB Entry: 4g7r, 3.05 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236A from Thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4g7rb1:

Sequence; same for both SEQRES and ATOM records:

>d4g7rb1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dehkahkailayekgwlafslamlfvfialiayt

Timeline for d4g7rb1:

• d4g7rb1 is new in SCOPe 2.04-stable
  
• d4g7rb1 appears in SCOPe 2.05
  
• d4g7rb1 appears in the current release, SCOPe 2.08