![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
![]() | Protein Cytochrome c oxidase [49544] (4 species) |
![]() | Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (29 PDB entries) |
![]() | Domain d4g72b2: 4g72 B:37-168 [252157] Other proteins in same PDB: d4g72a_, d4g72b1 automated match to d3qjsb2 complexed with cu, cua, has, hem, olc, per; mutant |
PDB Entry: 4g72 (more details), 3.19 Å
SCOPe Domain Sequences for d4g72b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g72b2 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg hqnmfgtivvke
Timeline for d4g72b2: