Lineage for d4g72b2 (4g72 B:37-168)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528012Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1528013Protein Cytochrome c oxidase [49544] (4 species)
  7. 1528083Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (29 PDB entries)
  8. 1528106Domain d4g72b2: 4g72 B:37-168 [252157]
    Other proteins in same PDB: d4g72a_, d4g72b1
    automated match to d3qjsb2
    complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g72b2

PDB Entry: 4g72 (more details), 3.19 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase mutant v236m from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4g72b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g72b2 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

SCOPe Domain Coordinates for d4g72b2:

Click to download the PDB-style file with coordinates for d4g72b2.
(The format of our PDB-style files is described here.)

Timeline for d4g72b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g72b1
View in 3D
Domains from other chains:
(mouse over for more information)
d4g72a_