![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.0: automated matches [227239] (1 protein) not a true family |
![]() | Protein automated matches [226999] (2 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries) |
![]() | Domain d4g72b1: 4g72 B:3-36 [252156] Other proteins in same PDB: d4g72a_, d4g72b2 automated match to d2qpdb2 complexed with cu, cua, has, hem, olc, per; mutant |
PDB Entry: 4g72 (more details), 3.19 Å
SCOPe Domain Sequences for d4g72b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g72b1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dehkahkailayekgwlafslamlfvfialiayt
Timeline for d4g72b1: