SCOPe 2.04: Domain d4g72b1: 4g72 B:3-36

Lineage for d4g72b1 (4g72 B:3-36)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.0: automated matches [227239] (1 protein)
   not a true family

6. Protein automated matches [226999] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries)

8. Domain d4g72b1: 4g72 B:3-36 [252156]
   Other proteins in same PDB: d4g72a_, d4g72b2
   automated match to d2qpdb2
   complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g72b1

PDB Entry: 4g72, 3.19 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase mutant v236m from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4g72b1:

Sequence; same for both SEQRES and ATOM records:

>d4g72b1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dehkahkailayekgwlafslamlfvfialiayt

Timeline for d4g72b1:

• d4g72b1 is new in SCOPe 2.04-stable
  
• d4g72b1 appears in SCOPe 2.05
  
• d4g72b1 appears in the current release, SCOPe 2.08