Lineage for d4g72b1 (4g72 B:3-36)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577253Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2577295Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2577425Family f.17.2.0: automated matches [227239] (1 protein)
    not a true family
  6. 2577426Protein automated matches [226999] (2 species)
    not a true protein
  7. 2577432Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries)
  8. 2577439Domain d4g72b1: 4g72 B:3-36 [252156]
    Other proteins in same PDB: d4g72a_, d4g72b2, d4g72c_
    automated match to d2qpdb2
    complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g72b1

PDB Entry: 4g72 (more details), 3.19 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase mutant v236m from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4g72b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g72b1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dehkahkailayekgwlafslamlfvfialiayt

SCOPe Domain Coordinates for d4g72b1:

Click to download the PDB-style file with coordinates for d4g72b1.
(The format of our PDB-style files is described here.)

Timeline for d4g72b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g72b2