Lineage for d4g72a_ (4g72 A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries)
  8. Domain d4g72a_: 4g72 A: [252155]
    Other proteins in same PDB: d4g72b1, d4g72b2, d4g72c_
    automated match to d3qjsa_
    complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g72a_

PDB Entry: 4g72 (more details), 3.19 Å

PDB Description: structure of recombinant cytochrome ba3 oxidase mutant v236m from thermus thermophilus
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d4g72a_:

Sequence, based on SEQRES records: (download)

>d4g72a_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
yeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltl
hgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvfalpllaneatv
lytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwl
mwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpimyfwllpayaiiytil
pkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslm
taftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftl
dyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflg
mmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsv
llsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfg
hlnpvpgwrlw

Sequence, based on observed residues (ATOM records): (download)

>d4g72a_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
yeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltl
hgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvfalpllaneatv
lytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwl
mwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpimyfwllpayaiiytil
pkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslm
taftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftl
dyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflg
mmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsv
llsrkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghl
npvpgwrlw

SCOPe Domain Coordinates for d4g72a_ are not available.

Timeline for d4g72a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4g72b1, d4g72b2, d4g72c_