Lineage for d1fnuc1 (1fnu C:601-707)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 297207Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 297262Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 297263Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 297266Domain d1fnuc1: 1fnu C:601-707 [25214]
    Other proteins in same PDB: d1fnua2, d1fnub2, d1fnuc2, d1fnud2

Details for d1fnuc1

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnuc1 b.40.2.2 (C:601-707) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnuc1:

Click to download the PDB-style file with coordinates for d1fnuc1.
(The format of our PDB-style files is described here.)

Timeline for d1fnuc1: