Lineage for d1fnuc1 (1fnu C:601-707)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166605Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 166656Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 166657Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 166660Domain d1fnuc1: 1fnu C:601-707 [25214]
    Other proteins in same PDB: d1fnua2, d1fnub2, d1fnuc2, d1fnud2

Details for d1fnuc1

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnuc1 b.40.2.2 (C:601-707) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnuc1:

Click to download the PDB-style file with coordinates for d1fnuc1.
(The format of our PDB-style files is described here.)

Timeline for d1fnuc1: