| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
| Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries) Uniprot P08095 |
| Domain d1fnuc1: 1fnu C:601-707 [25214] Other proteins in same PDB: d1fnua2, d1fnub2, d1fnuc2, d1fnud2 complexed with cd |
PDB Entry: 1fnu (more details), 1.94 Å
SCOPe Domain Sequences for d1fnuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnuc1 b.40.2.2 (C:601-707) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe
Timeline for d1fnuc1: