SCOPe 2.04: Domain d1fnub1: 1fnu B:301-407

Lineage for d1fnub1 (1fnu B:301-407)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
Uniprot P08095
Domain d1fnub1: 1fnu B:301-407 [25213]
Other proteins in same PDB: d1fnua2, d1fnub2, d1fnuc2, d1fnud2
complexed with cd

Details for d1fnub1

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

PDB Compounds: (B:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnub1 b.40.2.2 (B:301-407) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1fnub1:

Click to download the PDB-style file with coordinates for d1fnub1.
(The format of our PDB-style files is described here.)

Timeline for d1fnub1: