SCOP 1.59: Domain d1fnub1: 1fnu B:301-407

Lineage for d1fnub1 (1fnu B:301-407)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (4 PDB entries)

8. Domain d1fnub1: 1fnu B:301-407 [25213]
   Other proteins in same PDB: d1fnua2, d1fnub2, d1fnuc2, d1fnud2

Details for d1fnub1

PDB Entry: 1fnu, 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnub1:

Sequence; same for both SEQRES and ATOM records:

>d1fnub1 b.40.2.2 (B:301-407) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

Timeline for d1fnub1:

• d1fnub1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnub1 appears in SCOP 1.57
  
• d1fnub1 appears in SCOP 1.61
  
• d1fnub1 appears in the current release, SCOPe 2.08