Lineage for d4fzgu_ (4fzg U:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 2553062Domain d4fzgu_: 4fzg U: [252114]
    Other proteins in same PDB: d4fzga_, d4fzgb_, d4fzgc_, d4fzge_, d4fzgf_, d4fzgh_, d4fzgi_, d4fzgj_, d4fzgk_, d4fzgl_, d4fzgm_, d4fzgn_, d4fzgo_, d4fzgp_, d4fzgq_, d4fzgs_, d4fzgt_, d4fzgv_, d4fzgw_, d4fzgx_, d4fzgy_, d4fzgz_
    automated match to d1rypa_

Details for d4fzgu_

PDB Entry: 4fzg (more details), 3 Å

PDB Description: 20s yeast proteasome in complex with glidobactin
PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d4fzgu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fzgu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d4fzgu_:

Click to download the PDB-style file with coordinates for d4fzgu_.
(The format of our PDB-style files is described here.)

Timeline for d4fzgu_: