SCOPe 2.06: Domain d4fzge_: 4fzg E:

Lineage for d4fzge_ (4fzg E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4fzge_: 4fzg E: [252099]
   Other proteins in same PDB: d4fzgg_, d4fzgu_
   automated match to d4g4sf_

Details for d4fzge_

PDB Entry: 4fzg, 3 Å

PDB Description: 20s yeast proteasome in complex with glidobactin

PDB Compounds: (E:) Proteasome component PRE5

SCOPe Domain Sequences for d4fzge_:

Sequence; same for both SEQRES and ATOM records:

>d4fzge_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

Timeline for d4fzge_:

• d4fzge_ first appeared in SCOPe 2.04
  
• d4fzge_ appears in SCOPe 2.05
  
• d4fzge_ appears in SCOPe 2.07
  
• d4fzge_ appears in the current release, SCOPe 2.08