SCOPe 2.07: Domain d1et6b1: 1et6 B:4-96

Lineage for d1et6b1 (1et6 B:4-96)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Streptococcal superantigen Smez-2 [50236] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)

8. Domain d1et6b1: 1et6 B:4-96 [25209]
   Other proteins in same PDB: d1et6a2, d1et6b2

Details for d1et6b1

PDB Entry: 1et6, 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes

PDB Compounds: (B:) superantigen smez-2

SCOPe Domain Sequences for d1et6b1:

Sequence; same for both SEQRES and ATOM records:

>d1et6b1 b.40.2.2 (B:4-96) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
dnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaandfktg
dkiavfsvpfdwnylskgkvtaytyggitpyqk

Timeline for d1et6b1:

• d1et6b1 first appeared (with stable ids) in SCOP 1.55
  
• d1et6b1 appears in SCOPe 2.06
  
• d1et6b1 appears in the current release, SCOPe 2.08