Lineage for d1et6b1 (1et6 B:4-96)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 799193Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
  6. 799305Protein Streptococcal superantigen Smez-2 [50236] (1 species)
  7. 799306Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)
  8. 799310Domain d1et6b1: 1et6 B:4-96 [25209]
    Other proteins in same PDB: d1et6a2, d1et6b2

Details for d1et6b1

PDB Entry: 1et6 (more details), 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes
PDB Compounds: (B:) superantigen smez-2

SCOP Domain Sequences for d1et6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1et6b1 b.40.2.2 (B:4-96) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
dnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaandfktg
dkiavfsvpfdwnylskgkvtaytyggitpyqk

SCOP Domain Coordinates for d1et6b1:

Click to download the PDB-style file with coordinates for d1et6b1.
(The format of our PDB-style files is described here.)

Timeline for d1et6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1et6b2