Lineage for d1et6b1 (1et6 B:4-96)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789093Protein Streptococcal superantigen Smez-2 [50236] (1 species)
  7. 2789094Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)
  8. 2789098Domain d1et6b1: 1et6 B:4-96 [25209]
    Other proteins in same PDB: d1et6a2, d1et6b2

Details for d1et6b1

PDB Entry: 1et6 (more details), 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes
PDB Compounds: (B:) superantigen smez-2

SCOPe Domain Sequences for d1et6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1et6b1 b.40.2.2 (B:4-96) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
dnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaandfktg
dkiavfsvpfdwnylskgkvtaytyggitpyqk

SCOPe Domain Coordinates for d1et6b1:

Click to download the PDB-style file with coordinates for d1et6b1.
(The format of our PDB-style files is described here.)

Timeline for d1et6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1et6b2