Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [225675] (23 PDB entries) |
Domain d4fvvb1: 4fvv B:863-1076 [252087] Other proteins in same PDB: d4fvva2, d4fvvb2 automated match to d3r4sa1 complexed with gol, sia, so4 |
PDB Entry: 4fvv (more details), 2.7 Å
SCOPe Domain Sequences for d4fvvb1:
Sequence, based on SEQRES records: (download)
>d4fvvb1 b.29.1.0 (B:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]} sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti tfqmnkipntglitsdsdninmwirdfyifakel
>d4fvvb1 b.29.1.0 (B:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]} sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkltginfsktit fqmnkipntgsdninmwirdfyifakel
Timeline for d4fvvb1: