SCOP 1.73: Domain d1et6a1: 1et6 A:1A-95

Lineage for d1et6a1 (1et6 A:1A-95)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Streptococcal superantigen Smez-2 [50236] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)

8. Domain d1et6a1: 1et6 A:1A-95 [25208]
   Other proteins in same PDB: d1et6a2, d1et6b2

Details for d1et6a1

PDB Entry: 1et6, 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes

PDB Compounds: (A:) superantigen smez-2

SCOP Domain Sequences for d1et6a1:

Sequence; same for both SEQRES and ATOM records:

>d1et6a1 b.40.2.2 (A:1A-95) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
fktgdkiavfsvpfdwnylskgkvtaytyggitpyq

Timeline for d1et6a1:

• d1et6a1 first appeared (with stable ids) in SCOP 1.55
  
• d1et6a1 appears in SCOP 1.71
  
• d1et6a1 appears in SCOP 1.75
  
• d1et6a1 appears in the current release, SCOPe 2.08