Lineage for d1et6a1 (1et6 A:2A-95)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 297207Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 297292Protein Streptococcal superantigen Smez-2 [50236] (1 species)
  7. 297293Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)
  8. 297296Domain d1et6a1: 1et6 A:2A-95 [25208]
    Other proteins in same PDB: d1et6a2, d1et6b2

Details for d1et6a1

PDB Entry: 1et6 (more details), 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes

SCOP Domain Sequences for d1et6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1et6a1 b.40.2.2 (A:2A-95) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
fktgdkiavfsvpfdwnylskgkvtaytyggitpyq

SCOP Domain Coordinates for d1et6a1:

Click to download the PDB-style file with coordinates for d1et6a1.
(The format of our PDB-style files is described here.)

Timeline for d1et6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1et6a2