Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (29 species) not a true protein |
Domain d4fqza1: 4fqz A:1-154 [252072] automated match to d3ap6d_ complexed with edo; mutant |
PDB Entry: 4fqz (more details), 2.8 Å
SCOPe Domain Sequences for d4fqza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqza1 b.29.1.0 (A:1-154) automated matches {Human (Homo sapiens) [TaxId: 9606]} mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpra dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng khtllyghrigpekidtlgiygkvnihsigfsfs
Timeline for d4fqza1: