Lineage for d1eu3b1 (1eu3 B:2-96)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 463253Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 463361Protein Streptococcal superantigen Smez-2 [50236] (1 species)
  7. 463362Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)
  8. 463364Domain d1eu3b1: 1eu3 B:2-96 [25207]
    Other proteins in same PDB: d1eu3a2, d1eu3b2

Details for d1eu3b1

PDB Entry: 1eu3 (more details), 1.68 Å

PDB Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes

SCOP Domain Sequences for d1eu3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu3b1 b.40.2.2 (B:2-96) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
evdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaandfk
tgdkiavfsvpfdwnylskgkvtaytyggitpyqk

SCOP Domain Coordinates for d1eu3b1:

Click to download the PDB-style file with coordinates for d1eu3b1.
(The format of our PDB-style files is described here.)

Timeline for d1eu3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu3b2