SCOP 1.67: Domain d1eu3a1: 1eu3 A:2A-96

Lineage for d1eu3a1 (1eu3 A:2A-96)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Streptococcal superantigen Smez-2 [50236] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)

8. Domain d1eu3a1: 1eu3 A:2A-96 [25206]
   Other proteins in same PDB: d1eu3a2, d1eu3b2

Details for d1eu3a1

PDB Entry: 1eu3, 1.68 Å

PDB Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes

SCOP Domain Sequences for d1eu3a1:

Sequence; same for both SEQRES and ATOM records:

>d1eu3a1 b.40.2.2 (A:2A-96) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
fktgdkiavfsvpfdwnylskgkvtaytyggitpyqk

Timeline for d1eu3a1:

• d1eu3a1 first appeared (with stable ids) in SCOP 1.55
  
• d1eu3a1 appears in SCOP 1.65
  
• d1eu3a1 appears in SCOP 1.69
  
• d1eu3a1 appears in the current release, SCOPe 2.08