Lineage for d1eu3a1 (1eu3 A:2A-96)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59304Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 59372Protein Streptococcal superantigen Smez-2 [50236] (1 species)
  7. 59373Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)
  8. 59374Domain d1eu3a1: 1eu3 A:2A-96 [25206]
    Other proteins in same PDB: d1eu3a2, d1eu3b2

Details for d1eu3a1

PDB Entry: 1eu3 (more details), 1.68 Å

PDB Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes

SCOP Domain Sequences for d1eu3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu3a1 b.40.2.2 (A:2A-96) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
fktgdkiavfsvpfdwnylskgkvtaytyggitpyqk

SCOP Domain Coordinates for d1eu3a1:

Click to download the PDB-style file with coordinates for d1eu3a1.
(The format of our PDB-style files is described here.)

Timeline for d1eu3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu3a2