Lineage for d1eu4a1 (1eu4 A:1-95)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949887Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
  6. 950013Protein Streptococcal superantigen Spe-H [50234] (1 species)
  7. 950014Species Streptococcus pyogenes [TaxId:1314] [50235] (2 PDB entries)
  8. 950016Domain d1eu4a1: 1eu4 A:1-95 [25205]
    Other proteins in same PDB: d1eu4a2
    complexed with zn

Details for d1eu4a1

PDB Entry: 1eu4 (more details), 2.5 Å

PDB Description: crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
PDB Compounds: (A:) superantigen spe-h

SCOPe Domain Sequences for d1eu4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu4a1 b.40.2.2 (A:1-95) Streptococcal superantigen Spe-H {Streptococcus pyogenes [TaxId: 1314]}
nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvkdknlsvffekdwisqe
fkdkevdiyalsaqevcecpgkryeafggitltns

SCOPe Domain Coordinates for d1eu4a1:

Click to download the PDB-style file with coordinates for d1eu4a1.
(The format of our PDB-style files is described here.)

Timeline for d1eu4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu4a2