Lineage for d1et9a1 (1et9 A:1-95)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 463253Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 463375Protein Streptococcal superantigen Spe-H [50234] (1 species)
  7. 463376Species Streptococcus pyogenes [TaxId:1314] [50235] (2 PDB entries)
  8. 463377Domain d1et9a1: 1et9 A:1-95 [25204]
    Other proteins in same PDB: d1et9a2

Details for d1et9a1

PDB Entry: 1et9 (more details), 1.9 Å

PDB Description: crystal structure of the superantigen spe-h from streptococcus pyogenes

SCOP Domain Sequences for d1et9a1:

Sequence, based on SEQRES records: (download)

>d1et9a1 b.40.2.2 (A:1-95) Streptococcal superantigen Spe-H {Streptococcus pyogenes}
nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvkdknlsvffekdwisqe
fkdkevdiyalsaqevcecpgkryeafggitltns

Sequence, based on observed residues (ATOM records): (download)

>d1et9a1 b.40.2.2 (A:1-95) Streptococcal superantigen Spe-H {Streptococcus pyogenes}
nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvknlsvffekdwisqefk
dkevdiyalsaqeryeafggitltns

SCOP Domain Coordinates for d1et9a1:

Click to download the PDB-style file with coordinates for d1et9a1.
(The format of our PDB-style files is described here.)

Timeline for d1et9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1et9a2