Lineage for d4fmdd_ (4fmd D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867403Protein Rab1a [142241] (1 species)
  7. 2867404Species Human (Homo sapiens) [TaxId:9606] [142242] (3 PDB entries)
    Uniprot P62820 7-175
  8. 2867408Domain d4fmdd_: 4fmd D: [252038]
    automated match to d3l0ib_
    complexed with af3, gdp, mg, peg, pge

Details for d4fmdd_

PDB Entry: 4fmd (more details), 3.05 Å

PDB Description: EspG-Rab1 complex structure at 3.05 A
PDB Compounds: (D:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d4fmdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fmdd_ c.37.1.8 (D:) Rab1a {Human (Homo sapiens) [TaxId: 9606]}
peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

SCOPe Domain Coordinates for d4fmdd_:

Click to download the PDB-style file with coordinates for d4fmdd_.
(The format of our PDB-style files is described here.)

Timeline for d4fmdd_: