Lineage for d1hqrd1 (1hqr D:503-595)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 463253Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 463367Protein Streptococcal superantigen Spe-C [50232] (1 species)
  7. 463368Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries)
  8. 463370Domain d1hqrd1: 1hqr D:503-595 [25203]
    Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrb2, d1hqrd2

Details for d1hqrd1

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqrd1 b.40.2.2 (D:503-595) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

SCOP Domain Coordinates for d1hqrd1:

Click to download the PDB-style file with coordinates for d1hqrd1.
(The format of our PDB-style files is described here.)

Timeline for d1hqrd1: