Lineage for d1hqrd1 (1hqr D:503-595)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110417Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 110493Protein Streptococcal superantigen Spe-C [50232] (1 species)
  7. 110494Species Streptococcus pyogenes [TaxId:1314] [50233] (2 PDB entries)
  8. 110496Domain d1hqrd1: 1hqr D:503-595 [25203]
    Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrb2, d1hqrd2

Details for d1hqrd1

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqrd1 b.40.2.2 (D:503-595) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

SCOP Domain Coordinates for d1hqrd1:

Click to download the PDB-style file with coordinates for d1hqrd1.
(The format of our PDB-style files is described here.)

Timeline for d1hqrd1: