SCOP 1.73: Domain d1an8a1: 1an8 A:3-95

Lineage for d1an8a1 (1an8 A:3-95)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Streptococcal superantigen Spe-C [50232] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries)

8. Domain d1an8a1: 1an8 A:3-95 [25202]
   Other proteins in same PDB: d1an8a2

Details for d1an8a1

PDB Entry: 1an8, 2.4 Å

PDB Description: crystal structure of the streptococcal superantigen spe-c

PDB Compounds: (A:) streptococcal pyrogenic exotoxin c

SCOP Domain Sequences for d1an8a1:

Sequence; same for both SEQRES and ATOM records:

>d1an8a1 b.40.2.2 (A:3-95) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

Timeline for d1an8a1:

• d1an8a1 first appeared (with stable ids) in SCOP 1.55, called d1an8_1
  
• d1an8a1 was called d1an8_1 in SCOP 1.71
  
• d1an8a1 appears in SCOP 1.75
  
• d1an8a1 appears in the current release, SCOPe 2.08