Lineage for d1an8_1 (1an8 3-95)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 463253Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 463367Protein Streptococcal superantigen Spe-C [50232] (1 species)
  7. 463368Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries)
  8. 463369Domain d1an8_1: 1an8 3-95 [25202]
    Other proteins in same PDB: d1an8_2

Details for d1an8_1

PDB Entry: 1an8 (more details), 2.4 Å

PDB Description: crystal structure of the streptococcal superantigen spe-c

SCOP Domain Sequences for d1an8_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an8_1 b.40.2.2 (3-95) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

SCOP Domain Coordinates for d1an8_1:

Click to download the PDB-style file with coordinates for d1an8_1.
(The format of our PDB-style files is described here.)

Timeline for d1an8_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1an8_2