Lineage for d1an8_1 (1an8 3-95)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110417Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 110493Protein Streptococcal superantigen Spe-C [50232] (1 species)
  7. 110494Species Streptococcus pyogenes [TaxId:1314] [50233] (2 PDB entries)
  8. 110495Domain d1an8_1: 1an8 3-95 [25202]
    Other proteins in same PDB: d1an8_2

Details for d1an8_1

PDB Entry: 1an8 (more details), 2.4 Å

PDB Description: crystal structure of the streptococcal superantigen spe-c

SCOP Domain Sequences for d1an8_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an8_1 b.40.2.2 (3-95) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

SCOP Domain Coordinates for d1an8_1:

Click to download the PDB-style file with coordinates for d1an8_1.
(The format of our PDB-style files is described here.)

Timeline for d1an8_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1an8_2