Lineage for d1f77b1 (1f77 B:2-101)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 374369Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 374419Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)
  7. 374420Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries)
  8. 374424Domain d1f77b1: 1f77 B:2-101 [25201]
    Other proteins in same PDB: d1f77a2, d1f77b2
    complexed with so4

Details for d1f77b1

PDB Entry: 1f77 (more details), 2.4 Å

PDB Description: staphylococcal enterotoxin h determined to 2.4 a resolution

SCOP Domain Sequences for d1f77b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f77b1 b.40.2.2 (B:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

SCOP Domain Coordinates for d1f77b1:

Click to download the PDB-style file with coordinates for d1f77b1.
(The format of our PDB-style files is described here.)

Timeline for d1f77b1:

Domains from same chain:
(mouse over for more information)
d1f77b2
Domains from other chains:
(mouse over for more information)
d1f77a1, d1f77a2