SCOP 1.59: Domain d1ewca1: 1ewc A:2-101

Lineage for d1ewca1 (1ewc A:2-101)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries)

8. Domain d1ewca1: 1ewc A:2-101 [25199]
   Other proteins in same PDB: d1ewca2

Details for d1ewca1

PDB Entry: 1ewc, 1.95 Å

PDB Description: crystal structure of zn2+ loaded staphylococcal enterotoxin h

SCOP Domain Sequences for d1ewca1:

Sequence; same for both SEQRES and ATOM records:

>d1ewca1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

Timeline for d1ewca1:

• d1ewca1 first appeared (with stable ids) in SCOP 1.55
  
• d1ewca1 appears in SCOP 1.57
  
• d1ewca1 appears in SCOP 1.61
  
• d1ewca1 appears in the current release, SCOPe 2.08