Lineage for d1enfa1 (1enf A:2-101)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667804Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 667864Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)
  7. 667865Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries)
  8. 667866Domain d1enfa1: 1enf A:2-101 [25198]
    Other proteins in same PDB: d1enfa2
    complexed with so4

Details for d1enfa1

PDB Entry: 1enf (more details), 1.69 Å

PDB Description: crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
PDB Compounds: (A:) enterotoxin h

SCOP Domain Sequences for d1enfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enfa1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

SCOP Domain Coordinates for d1enfa1:

Click to download the PDB-style file with coordinates for d1enfa1.
(The format of our PDB-style files is described here.)

Timeline for d1enfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1enfa2