Lineage for d4fg6f1 (4fg6 F:1-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035230Domain d4fg6f1: 4fg6 F:1-106 [251968]
    Other proteins in same PDB: d4fg6a_, d4fg6b_, d4fg6d2, d4fg6f2
    automated match to d1ikfl1
    mutant

Details for d4fg6f1

PDB Entry: 4fg6 (more details), 3.02 Å

PDB Description: structure of ecclc e148a mutant in glutamate
PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d4fg6f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fg6f1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d4fg6f1:

Click to download the PDB-style file with coordinates for d4fg6f1.
(The format of our PDB-style files is described here.)

Timeline for d4fg6f1: