SCOPe 2.07: Domain d4fegb1: 4feg B:9-182

Lineage for d4fegb1 (4feg B:9-182)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:644042] [256254] (3 PDB entries)

8. Domain d4fegb1: 4feg B:9-182 [251960]
   Other proteins in same PDB: d4fega2, d4fegb2
   automated match to d1powa2
   complexed with fad, gol, mg, po4, pyr, tdm

Details for d4fegb1

PDB Entry: 4feg, 1.09 Å

PDB Description: High-resolution structure of pyruvate oxidase in complex with reaction intermediate 2-hydroxyethyl-thiamin diphosphate carbanion-enamine, crystal A

PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d4fegb1:

Sequence; same for both SEQRES and ATOM records:

>d4fegb1 c.36.1.0 (B:9-182) automated matches {Lactobacillus plantarum [TaxId: 644042]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw

Timeline for d4fegb1:

• d4fegb1 first appeared in SCOPe 2.04
  
• d4fegb1 appears in SCOPe 2.06
  
• d4fegb1 appears in the current release, SCOPe 2.08