Lineage for d4feeb2 (4fee B:183-365)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471274Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2471275Protein automated matches [190312] (14 species)
    not a true protein
  7. 2471348Species Lactobacillus plantarum [TaxId:644042] [256255] (3 PDB entries)
  8. 2471352Domain d4feeb2: 4fee B:183-365 [251955]
    Other proteins in same PDB: d4feea1, d4feea3, d4feeb1, d4feeb3
    automated match to d1powa1
    complexed with fad, gol, mg, po4, pyr, tdm

Details for d4feeb2

PDB Entry: 4fee (more details), 1.13 Å

PDB Description: High-resolution structure of pyruvate oxidase in complex with reaction intermediate 2-hydroxyethyl-thiamin diphosphate carbanion-enamine, crystal B
PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d4feeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4feeb2 c.31.1.0 (B:183-365) automated matches {Lactobacillus plantarum [TaxId: 644042]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

SCOPe Domain Coordinates for d4feeb2:

Click to download the PDB-style file with coordinates for d4feeb2.
(The format of our PDB-style files is described here.)

Timeline for d4feeb2: