| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Lactobacillus plantarum [TaxId:644042] [256254] (3 PDB entries) |
| Domain d4feea3: 4fee A:366-594 [251953] Other proteins in same PDB: d4feea2, d4feeb2 automated match to d1powa3 complexed with fad, gol, mg, po4, pyr, tdm |
PDB Entry: 4fee (more details), 1.13 Å
SCOPe Domain Sequences for d4feea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4feea3 c.36.1.0 (A:366-594) automated matches {Lactobacillus plantarum [TaxId: 644042]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddl
Timeline for d4feea3: