SCOPe 2.04: Domain d1sebh1: 1seb H:2-121

Lineage for d1sebh1 (1seb H:2-121)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (14 PDB entries)

8. Domain d1sebh1: 1seb H:2-121 [25195]
   Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh2

Details for d1sebh1

PDB Entry: 1seb, 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

PDB Compounds: (H:) enterotoxin type b

SCOPe Domain Sequences for d1sebh1:

Sequence, based on SEQRES records:

>d1sebh1 b.40.2.2 (H:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records):

>d1sebh1 b.40.2.2 (H:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtydnvr
vefknkdladkykdkyvdvfganyyyqcyfskkktcmyggvteh

Timeline for d1sebh1:

• d1sebh1 first appeared (with stable ids) in SCOP 1.55
  
• d1sebh1 appears in SCOPe 2.03
  
• d1sebh1 appears in SCOPe 2.05
  
• d1sebh1 appears in the current release, SCOPe 2.08