Lineage for d1sebd1 (1seb D:2-121)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 228958Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 228959Species Staphylococcus aureus [TaxId:1280] [50227] (13 PDB entries)
  8. 228974Domain d1sebd1: 1seb D:2-121 [25194]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh2

Details for d1sebd1

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

SCOP Domain Sequences for d1sebd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebd1 b.40.2.2 (D:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtydnvr
vefknkdladkykdkyvdvfganyyyqcyfskkktcmyggvteh

SCOP Domain Coordinates for d1sebd1:

Click to download the PDB-style file with coordinates for d1sebd1.
(The format of our PDB-style files is described here.)

Timeline for d1sebd1: