Lineage for d4f9ld2 (4f9l D:132-254)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035452Domain d4f9ld2: 4f9l D:132-254 [251936]
    automated match to d1f3rb1
    complexed with nag

Details for d4f9ld2

PDB Entry: 4f9l (more details), 3.14 Å

PDB Description: crystal structure of the human btn3a1 ectodomain in complex with the 20.1 single chain antibody
PDB Compounds: (D:) 20.1 anti-BTN3A1 antibody fragment

SCOPe Domain Sequences for d4f9ld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f9ld2 b.1.1.0 (D:132-254) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqesgaelvkpgasvklsckasgytftryylywvkqrpgqglewigeinpnnggtkf
nekfkskatltvdkssrttyiqlssltsedsavyycsreddydgtpdamdywgqgtavtv
ssa

SCOPe Domain Coordinates for d4f9ld2:

Click to download the PDB-style file with coordinates for d4f9ld2.
(The format of our PDB-style files is described here.)

Timeline for d4f9ld2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f9ld1