SCOPe 2.05: Domain d4f9lc2: 4f9l C:132-254

Lineage for d4f9lc2 (4f9l C:132-254)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4f9lc2: 4f9l C:132-254 [251934]
   automated match to d1f3rb1
   complexed with nag

Details for d4f9lc2

PDB Entry: 4f9l, 3.14 Å

PDB Description: crystal structure of the human btn3a1 ectodomain in complex with the 20.1 single chain antibody

PDB Compounds: (C:) 20.1 anti-BTN3A1 antibody fragment

SCOPe Domain Sequences for d4f9lc2:

Sequence; same for both SEQRES and ATOM records:

>d4f9lc2 b.1.1.0 (C:132-254) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqesgaelvkpgasvklsckasgytftryylywvkqrpgqglewigeinpnnggtkf
nekfkskatltvdkssrttyiqlssltsedsavyycsreddydgtpdamdywgqgtavtv
ssa

Timeline for d4f9lc2:

• d4f9lc2 first appeared in SCOPe 2.04
  
• d4f9lc2 appears in SCOPe 2.06
  
• d4f9lc2 appears in the current release, SCOPe 2.08