Lineage for d4f9lc1 (4f9l C:1-109)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767300Domain d4f9lc1: 4f9l C:1-109 [251933]
    automated match to d1f3rb2
    complexed with nag

Details for d4f9lc1

PDB Entry: 4f9l (more details), 3.14 Å

PDB Description: Crystal Structure of the Human BTN3A1 Ectodomain in Complex with the 20.1 Single Chain Antibody
PDB Compounds: (C:) 20.1 anti-BTN3A1 antibody fragment

SCOPe Domain Sequences for d4f9lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f9lc1 b.1.1.0 (C:1-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspsslsaslgdtititchasqninlwlswyqqrpgnipklliyrasnlhtgvps
rfsgsgsatgftltisslqpediatyycqqghsypytfgggtkldikra

SCOPe Domain Coordinates for d4f9lc1:

Click to download the PDB-style file with coordinates for d4f9lc1.
(The format of our PDB-style files is described here.)

Timeline for d4f9lc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f9lc2