Lineage for d4f83a2 (4f83 A:1072-1280)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062365Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2062366Protein automated matches [190445] (6 species)
    not a true protein
  7. 2062372Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)
  8. 2062375Domain d4f83a2: 4f83 A:1072-1280 [251925]
    Other proteins in same PDB: d4f83a1, d4f83a3
    automated match to d3pmea2
    complexed with gol, pg4, so4

Details for d4f83a2

PDB Entry: 4f83 (more details), 1.7 Å

PDB Description: Crystal structure of the receptor binding domain of botulinum neurotoxin mosaic serotype C/D with a tetraethylene glycol molecule bound on the Hcn sub-domain and a sulfate ion at the putative active site
PDB Compounds: (A:) Type C neurotoxin

SCOPe Domain Sequences for d4f83a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f83a2 b.42.4.0 (A:1072-1280) automated matches {Clostridium botulinum [TaxId: 1491]}
snedinivyegqilrnvikdywgnplkfdteyyminynyidryiapknnilvlvqysdis
klytknpitiksaanknpysrilngddimfhmlydsreymiirdtdtiyatqggqcsknc
vyalklqsnlgnygigifsiknivsqnkycsqifssfmkntmlladiykpwrfsfenayt
pvavtnyetkllstssfwkfisrdpgwve

SCOPe Domain Coordinates for d4f83a2:

Click to download the PDB-style file with coordinates for d4f83a2.
(The format of our PDB-style files is described here.)

Timeline for d4f83a2: