Lineage for d4f77z_ (4f77 Z:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539178Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1539383Protein D2 core SNRNP protein [50186] (2 species)
  7. 1539384Species Human (Homo sapiens) [TaxId:9606] [50187] (5 PDB entries)
  8. 1539394Domain d4f77z_: 4f77 Z: [251923]
    Other proteins in same PDB: d4f774_, d4f77a_, d4f77d_, d4f77f_, d4f77g_, d4f77h_, d4f77i_, d4f77l_, d4f77n_, d4f77o_, d4f77p_, d4f77q_, d4f77t_, d4f77v_, d4f77w_, d4f77x_, d4f77y_
    automated match to d4f7ud_
    complexed with so4

Details for d4f77z_

PDB Entry: 4f77 (more details), 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate
PDB Compounds: (Z:) Small nuclear ribonucleoprotein Sm D2

SCOPe Domain Sequences for d4f77z_:

Sequence, based on SEQRES records: (download)

>d4f77z_ b.38.1.1 (Z:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
lenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliag

Sequence, based on observed residues (ATOM records): (download)

>d4f77z_ b.38.1.1 (Z:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
lenvkemwtevpvnkdryiskmflrgdsvivvlrnpliag

SCOPe Domain Coordinates for d4f77z_:

Click to download the PDB-style file with coordinates for d4f77z_.
(The format of our PDB-style files is described here.)

Timeline for d4f77z_: