Lineage for d2sebd1 (2seb D:2-121)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559492Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 559511Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 559512Species Staphylococcus aureus [TaxId:1280] [50227] (12 PDB entries)
  8. 559524Domain d2sebd1: 2seb D:2-121 [25192]
    Other proteins in same PDB: d2seba1, d2seba2, d2sebb1, d2sebb2, d2sebd2
    complexed with nag

Details for d2sebd1

PDB Entry: 2seb (more details), 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

SCOP Domain Sequences for d2sebd1:

Sequence, based on SEQRES records: (download)

>d2sebd1 b.40.2.2 (D:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d2sebd1 b.40.2.2 (D:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikydnvrve
fknkdladkykdkyvdvfganyyyqcyfskrktcmyggvteh

SCOP Domain Coordinates for d2sebd1:

Click to download the PDB-style file with coordinates for d2sebd1.
(The format of our PDB-style files is described here.)

Timeline for d2sebd1: